PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589497.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 272aa    MW: 31404.3 Da    PI: 7.5414
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589497.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding431e-131663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ed++l+d++  +G  +W++++   g++R +k+c++rw +yl
   XP_009589497.1 16 KGLWSPDEDQKLKDYIITYGHVCWSSVPINAGLKRNGKSCRLRWINYL 63
                     678*****************99**********9*************97 PP

2Myb_DNA-binding49.59.9e-1670114248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g+++teEde ++ ++ +  ++ W++Ia++++ gRt++++k++w++yl
   XP_009589497.1  70 GAFSTEEDETILTLHSMISSK-WSRIAQHLP-GRTDNEIKNHWHSYL 114
                      689******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.7461167IPR017930Myb domain
SuperFamilySSF466891.58E-2614110IPR009057Homeodomain-like
SMARTSM007175.3E-121565IPR001005SANT/Myb domain
PfamPF002495.4E-121663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-191770IPR009057Homeodomain-like
CDDcd001677.21E-91963No hitNo description
SMARTSM007172.3E-1268116IPR001005SANT/Myb domain
PROSITE profilePS5129417.37468118IPR017930Myb domain
PfamPF002494.5E-1470114IPR001005SANT/Myb domain
CDDcd001672.41E-871113No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2371118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MRCKPTVDKP KQKHKKGLWS PDEDQKLKDY IITYGHVCWS SVPINAGLKR NGKSCRLRWI  60
NYLRPGLKLG AFSTEEDETI LTLHSMISSK WSRIAQHLPG RTDNEIKNHW HSYLKKRLAK  120
KAKSEGQSQN IDVVSSSSSS LKLTWRNSSL DSFAQTEGSL ADTDQDFSLV DFLKEPRKSK  180
FRKVLFAEWF SLDQFNVQDF QNSDLSKNNL CYNSLEFQDA FMMSKGAYEN DINIQGINNE  240
TVDDDMFQAQ LKFEDQLSTN GFEELLYGDF NI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-22161187108B-MYB
1h8a_C3e-221611827128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589497.10.0PREDICTED: transcription factor LAF1
TrEMBLM1B4S41e-118M1B4S4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000370801e-117(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.18e-60myb domain protein 19